PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007153-PA
Common NameOsI_05804
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 1067aa    MW: 118456 Da    PI: 6.0792
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007153-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B361.11.9e-19154241183
                       EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                       f+k+lt sd++++g +++p++ ae++       + +++  ++l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+  
  BGIOSGA007153-PA 154 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QELQARDIHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVIVV 241
                       99*****************************954.4444.49********************************************9876 PP

2Auxin_resp47.38.7e-172472883677
        Auxin_resp  36 kvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnS 77 
                       ++++s+GmRf+m+fete+  +rr++Gt++g+sdldpv W +S
  BGIOSGA007153-PA 247 SNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVGWDES 288
                       5899***********************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575132No hitNo description
SuperFamilySSF1019361.83E-37143260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.2E-34146250IPR015300DNA-binding pseudobarrel domain
CDDcd100174.49E-17153239No hitNo description
SMARTSM010191.1E-15154258IPR003340B3 DNA binding domain
PROSITE profilePS508639.869154258IPR003340B3 DNA binding domain
PfamPF023623.7E-17154241IPR003340B3 DNA binding domain
PfamPF065078.0E-12247288IPR010525Auxin response factor
PfamPF023093.7E-99311019IPR033389AUX/IAA domain
PROSITE profilePS5174529.2589341018IPR000270PB1 domain
SuperFamilySSF542773.53E-79521013No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1067 aa     Download sequence    Send to blast
MASMKQQQTP ASSAVTAAAA ASSSATAAVA ACEGERKAAA INSELWHACA GPLVSLPPVG  60
SLVVYFPQGH SEQVYKSNIV AASMQKDVDA HVPSYPNLPS KLICLLHGVN LHADPDTDEV  120
YAQMTLQPVN TYGKEALQLS ELALKQARPQ MEFFCKTLTA SDTSTHGGFS VPRRAAEKIF  180
PPLDFSMQPP AQELQARDIH DNVWTFRHIY RGQPKRHLLT TGWSLFVSGK RLFAGDSVIV  240
VRRHCDSNQI SLGMRFRMMF ETEELGTRRY MGTITGISDL DPVGWDESAA GERRNRVSIW  300
EIEPVAAPFF LCPQPFFGVK RPRQLDDESE MENLFKRAMP WLGEEVCIKD TQNQNSTAPG  360
LSLVQWMNMN RQQSSSLANT AAQSEYLQAL GNPAMQNLAA DELARQLYVQ NNLLQQNCIQ  420
FNSPKLPQQM QTMNDLSKAA IPLNQLGAII NPQDQKQDAV NHQRQQNSIQ VIPLSQAQSN  480
LVQAQVIVQN QMQQQKPSPT QNPQRINGQR LLLSHQQKDQ NLQLQQQLLL QQKQQLQQQQ  540
QQQQQNQQQL NKSLGQLVNL ASQQSKLFDE ELQLQILQKL QQQSLMSQST STLSQPPLIQ  600
EQQKLITDMQ KQLSNSHSLA QQQMMPQQEI KPSLQATPLL PTVQQEQQQK LLQKQVSLAD  660
VSGVAFQPIS STNVIPKTGG AMIISGATQS VVTEEMPSCS TSPSTANGNH FTQSTKNRHC  720
INTERLPPST APMLIPTSID AVTATPLMTK ELPKPNNNVK QSVVNSKLPN VAPGPQNCIN  780
HALQTDNLET SSSATSLCPS RTDGLVHQGF PSSNFNQHQM FKDALPDVEM EGVDPSNSCL  840
FGINNDNLLG FPIETEDLLI NALDSVKYQN HISTDVENNY PMQKDALQEI STSMVSQSFG  900
QSDMAFNSID SAINDGAFLN KNSWPAAPLL QRMRTFTKVY KRGAVGRSID IGRYSGYEEL  960
KHALARMFGI EGQLEDRQRI GWKLVYKDHE DDILLLGDDP WEEFVNCVRC IRILSPQEVQ  1020
QMSLDGDLGS NVLPNQACSS SDGVNGWRPR CDQNPGNPSI GPYDQFE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A3e-893430345388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.214540.0callus| leaf| stem
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0052940.0AP005294.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1679_B08.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627050.10.0PREDICTED: auxin response factor 5 isoform X2
SwissprotQ6Z2W30.0ARFE_ORYSJ; Auxin response factor 5
TrEMBLB8AHF10.0B8AHF1_ORYSI; Auxin response factor
STRINGBGIOSGA007153-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140935106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.12e-92auxin response factor 19